PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_92CBBE968.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 343aa    MW: 36519.3 Da    PI: 9.5487
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_92CBBE968.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171964147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           +g+W++eEd+ l ++v ++G ++W++I++ ++ gR++k+c++rw + 
  Traes_5DL_92CBBE968.1 19 KGPWSPEEDDALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 64
                           79******************************.***********985 PP

2Myb_DNA-binding51.81.9e-1673115347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T++Ed+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Traes_5DL_92CBBE968.1  73 PFTPDEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 115
                            89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.7161469IPR017930Myb domain
SuperFamilySSF466893.22E-3116112IPR009057Homeodomain-like
SMARTSM007171.0E-151867IPR001005SANT/Myb domain
PfamPF002491.5E-171964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-252072IPR009057Homeodomain-like
CDDcd001675.84E-152163No hitNo description
SMARTSM007177.2E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129419.74771120IPR017930Myb domain
CDDcd001674.40E-1173116No hitNo description
PfamPF002495.8E-1473115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2373119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MAACRAGGGG GGRDVDRIKG PWSPEEDDAL QRLVGRHGAR NWSLISKSIP GRSGKSCRLR  60
WCNQLSPQVE HRPFTPDEDD TILRAHARFG NKWATIARLL SGRTDNAIKN HWNSTLKRKY  120
SSSSSTSASA SASPADDAMA NDDDDRRPLK RTSSDGYPGL CFSPGSPSGS DLSDSSHQSL  180
PSVMPSAASQ QPHVYRPVAR AGGVVVLPTA TPQLPQPSPP SPPPPPPPPA TSLSLSLSLP  240
GLDAPEPAPV AQAQPMSMPP PPAHVPVQPA AAPQMPPPMP FQLQPPPVPQ ARAAAPFNGE  300
FLSMMQEMIR IEVRNYMSGF DPRSSPADGV HAAKRMMSMA KIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-39161194107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3552410.0AK355241.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1018A13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151336.11e-126sucrose responsive element binding protein
TrEMBLW5FW390.0W5FW39_WHEAT; Uncharacterized protein
STRINGMLOC_64817.11e-143(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.18e-66myb domain protein 70
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]